Sign In | Join Free | My himfr.com
himfr.com
Products
Search by Category
Wholesale Marketplace
Home > Environment >

Environment Projects

Environment Projects

All Environment Projects wholesalers & Environment Projects manufacturers come from members. We doesn't provide Environment Projects products or service, please contact them directly and verify their companies info carefully.

Total 4953 products from Environment Projects Manufactures & Suppliers
Wholesale C9NN7563F New Ford New Holland Tractor Pressure Plate Single Clutch 4400 4500 from china suppliers

Brand Name:JIAHANG

Model Number:C9NN7563D Ford Tractor 2000 3000 Pressure Plate Cover Assembly 11" Single Clutch

Place of Origin:jiangsuyancheng

...C9NN7563D Ford Tractor 2000 3000 Pressure Plate Cover Assembly 11" Single Clutch Fits Allis Chalmers Tractor(s) 5015 Fits Case IH Tractor(s) 235 Replaces Case IH ...

YanCheng JIAHANG Clutch Co., Ltd.
Site Member

Jiangsu

Wholesale Summer Curtain DESIGN-2 in 2018 from china suppliers

Brand Name:kingsun

Model Number:WHL170920-12

Place of Origin:China

Details 1.Bright color, color uniformity,resistant to crushing and printable nice. 2.Soft hand feeling. 3.a variety of embroideries. 4.Good Quality:We have strict quality control system .Good reputation in the market. 5.Low MOQ: we can meet your ...

SHIJIAZHUANG KINGSUN TEXTILE IMP. & EXP. CO., LTD
Active Member

Wholesale Original GE NIBP Cuff for large adult, 2204, 31-40CM from china suppliers

Brand Name:GE

Model Number:2204

Original GE NIBP Cuff for large adult, 2204, 31-40CM Many other original accessories are available, if you need any, please feel free to contact us.

HongKong BiocareMed Co.,Ltd
Site Member

Guangdong

Wholesale RAILING GLASS PROFILE METAL STAINLESS STEEL CHANNEL CHINA SUPPLIER from china suppliers

Brand Name:stainless steel metal tile trim

Model Number:stainless steel,aluminum

Place of Origin:Foshan,China

RAILING GLASS PROFILE METAL STAINLESS STEEL CHANNEL We supply stainless steel channel trim, angle trim,shape( U, J, Z,L,T) trim and other decorative trim in grade 304/ 304L/ 316/ 316L. U & J Channels with either equal or unequal legs at 90 degrees is most...

Foshan Xin Tai Jia Stainless Steel Co.,Ltd
Site Member

Guangdong

Wholesale Garment Accessories Ivory  Eyelash Fancy  Lace   Chantilly Bridal Dress Fabric in Ivory Black double color Stock from china suppliers

Brand Name:bluesea

Model Number:9524

Place of Origin:GuangDong,China.

150cm * 300cm 2017 New Fashion Eyelash Lace Fabric Like Maple Leaf in Black color Item Number : 9524 Color: Black, Measure 150 *300 cm Weight Mesh Swiss Mesh ,not very soft. Coposition 100% polyester, Decoration With EYELASH Supply Type Color,Size can be ...

Blue Sea Embroidery Lace Company
Site Member

Wholesale high loadability Event dance floor for wedding venue from china suppliers

Brand Name:RK

Place of Origin:Shenzhen,China

Contact Contact person:Rachel Wang skype: sd80012 whatsapp/ mob.: +8613246689494 sales05 # pipedrapesystems.com (change # to @) Folding hotsale dance floor size RK provide High Quality portable white dance floor for sale Dance floors come in a variety of ...

Rack in the cases
Active Member

Wholesale Low price stainless steel strap color available of pair watches for lovers from china suppliers

Brand Name:Seeteng

Model Number:SW1092

Place of Origin:Fuzhou, Fujian, China

Theme: Low price stainless steel strap color available of pair watches for lovers A, Why Clients Choose Us? 1. Factory direct supply —— Competitive Price ! 2. Expert man-made skills —— Good Quality ! 3. Strong productivity —— On-Time Delivery ...

FUZHOU SEETENG ELECTRONIC.CO.TLD
Site Member

Jiangxi

Wholesale fecral electrical resistance heating alloy wire from china suppliers

Brand Name:shinerefractories

Place of Origin:China

fecral electrical resistance heating alloy wire Characteristic: FeCrAl Electrical Resistance Heating alloys with high electrical resistivity, temperature coefficient of resistance is small, high operating temperature. good corrosion resistance under high ...

Shine Technology Co., Ltd
Active Member

Beijing

Wholesale Heavy Duty Caster from china suppliers

Place of Origin:China

Heavy Duty Caster Supper heavy duty PU with iron core series: bracket thickness:12 mm polished galvanized surface treatment Lasting light more Antirust Riveting technology high loading capacity Wide useful environment PU Brake Heavy Duty Caster, 2 Ton ...

Yutong Caster Products Factory
Active Member

Wholesale Cardboard Baler Prices from china suppliers

Brand Name:SINOBALER

Place of Origin:CHINA

Cardboard baler is the important step to compress cardboard waste into tight bale for easy transportation and storage. Before making a decision to invest a cardboard baler, cardboard recycler should be interested in have a cardboard baler price first. ...

SINOBALER Machinery Company Limited
Active Member

Wholesale Programmable LED Pharmacy Cross Signs Small Size Display Animated Message from china suppliers

Brand Name:CGX

Model Number:PL006

Place of Origin:Guangzhou, China

Programmable LED Pharmacy Cross Signs Small Size Display Animated Message Double sided led pharmacy cross is a very effective communication and advertising tool, which can display animated text indoor or outdoor to highlight your pharmacies sign in the ...

Guangzhou Baiyun CGX Electronic Factory
Active Member

Guangdong

Wholesale fiberglass amusement park ride kids outdoor battery inflatable electric bumper car spin bumper car for sale from china suppliers

Brand Name:huaqin

Model Number:BP-002

Place of Origin:Made in China

fiberglass amusement park ride kids outdoor battery inflatable electric bumper car spin bumper car for sale Where To Use Square,park,playground Material Acrylic,hardware Battery time 8-12 hour Power 250W Size L1400*W500*H620mm Start mode Remote control, ...

Guangzhou HuaQin Playground Equipment Co.,ltd
Active Member

Guangdong

Wholesale Max.tank diameter 4m, SG4 powerful jet tank cleaning spray nozzle for cleaning of small to medium sized tanks from china suppliers

Brand Name:KLY

Model Number:SG4 powerful jet tank cleaning spray nozzle

Place of Origin:CN

SG4 powerful jet tank cleaning spray nozzle Model SG4 tank cleaning spray nozzle Material 316L ss Bearing Slide bearing Operating pressure 3-14bar Max. pressure 20 bar Max. tank diameter 4m Diameter 49mm Filtration line strainer with a mesh size of 80 or ...

Guangzhou cleaning-spray Equipment Co., Ltd
Active Member

Guangdong

Wholesale DH80-7 gear pump pilot pump charge pump for DOOSAN DAEWOO excavator from china suppliers

Brand Name:Sailfish

Model Number:DH80-7

Place of Origin:CHINA

DH80-7 gear pump pilot pump charge pump for DOOSAN DAEWOO excavator contact imfoemation:

Sailfish Machinery&Equipment co.,ltd
Site Member

Guangdong

Wholesale Personalized Handmade High Quality Crystal Red Wine Glass White Wine Glass from china suppliers

Brand Name:Almayca

Model Number:Al-518

Place of Origin:China

Introduction of Personalized Handmade High Quality Crystal Red Wine Glass White Wine Glass Supply Personalized Handmade High Quality Crystal Red Wine Glass White Wine Glass are top class 518ml crystal wine glasses that widely used for hotel, party, ...

Shandong Almayca Arts & Crafts Co,Ltd
Active Member

Wholesale 360° Rotation 18 Times Zoom Underwater Camera with LED Lights VVL-KS-Z,Sea Observation from china suppliers

Place of Origin:Weihai,China

Brand Name:VVLAI

Model Number:VVL-KS-Z

360° Rotation Underwater Camera 18 Times Zoom Camera with LED Light VVL-KS-Z 1. Product Image: 2. Technical Specification: 1) 7inch high light LCD Screen 2) 2*5W LED light 3) DVR/USB port 4) 18 times zoom camera 5)10M-100M Cable It can equip with 7M long...

Shandong Future Robot Co.,Ltd
Site Member

Shandong

Wholesale China Supplier EKEMP Android POS System with RFID, Smart Card Reader, Thermal Printer, Touch Screen from china suppliers

Brand Name:EKEMP

Model Number:P10

Place of Origin:China(Mainland)

China Supplier EKEMP Android POS System with RFID, Smart Card Reader, Thermal Printer, Touch Screen 10.1 inch high-definition touch screen,new Android 4.2.2 operating system, brings a smooth operation and strong performance. Unique bar code scanning and ...

EKEMP INT'L LIMITED
Active Member

Wholesale hot selling 230w beam moving head/glass gobos 230w moving head light/double prism 7r moving head dmx512 from china suppliers

Brand Name:Vesitian

Place of Origin:CHINA

Model Number:vm230

hot selling 230w beam moving head/glass gobos 230w moving head light/double prism 7r moving head dmx512 Input Voltage: AC100-240V 50/60HZ Power Consumption: 230W Control Protocol: DMX512 Channel: 16CH Dimming: 0-100% linear adjustment Strobe: heat-proof ...

Guangzhou Vesitian lighting equipment factory
Active Member

Guangdong

Wholesale gypsum board equipment from china suppliers

Brand Name:Xiangyi

Place of Origin:Hebei, China

gypsum board processing line gypsum board equipment Finished gypsum board Specification Dimension of gypsum board: Thickness: 7mm-22mm width: 1200mm or 1220mm length: 1800mm~3600mm Types of Gypsum Board a) Common paper surface gypsum board b) Fireproof ...

Hebei Xiangyi Mechanical Co.,Ltd
Active Member

Liaoning

Wholesale High pure Sermorelin Acetate white color powder with fast delivery from Chinese reliable supplier from china suppliers

Brand Name:Youngshe

Model Number:high quality

Place of Origin:China

Sermorelin Acetate Name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known as: Geref, UNII-...

Chengdu YoungShe Chemical Co., Ltd
Active Member

Sichuan

Go to Page
Inquiry Cart 0